dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSMMUP00000022460 (Macaca mulatta 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:MMUL_1:19:50489793:50501645:1 gene:ENSMMUG00000021469 transcript:ENSMMUT00000023995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 488
Sequence
MTTSKEAVTFKDVVVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQPFHRDTFHFL
REEKFWMMDIATQREGNSGGKIQPEMKTVPEAGPHEGLSCQQIWEEIASDLTRPQDSTTN
SSQFFEQGDAHSQVEEGLSIMHTGQKPSNHGKCKPSFSDVSIFDLPQQIHSAEKSHSRDE
CGKSFCYISALHIHQRVHLGEKLFKCDVCGKEFSQSLHLQTHQRVHTGEKPFKCEQCGRG
FRCRSALTVHCKLHMGEKHYNCEACGRAFIHDIQLQKHQRIHTGEKPFKCEICSMSFRLR
SSLNRHCVVHTGKKPNNTGEYGKGFIGRLDLCKHQTIHTGEKPYNCKECGKSFRRSSYLL
IHQRVHTGEKPYKCDKCGKSYITKSGLDLHHRAHTGERPYNCDDCGKSFRQASSILNHKR
LHCQKKPFKCEDCGKKLVHRSYRKKLVHRSDQPRDHSGENPSKCEDCGKRYKRRLNLDII
LSLFLNDT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]