dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|29830757|ref|NP_825391.1| (Streptomyces avermitilis MA-4680)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein SAV_4214 [Streptomyces avermitilis MA-4680]
Sequence length 305
Sequence
MATTDRQATTLALAHALSAAERGLAVIPLSRTKLPALRSPHRATSDRTPSDRGTPRHDVP
GPTAPVCHGECGRFGHGVYDASTDPRRIRRLFAAAPWATGYGIACGLHPHFLIGIDLDTK
SGTDSSAALRELALRHLFTIPDTVVVLTPSGGRHVWLSGPPDVVVPNSAGRLAPGIDIRG
AGGYLVGPGSRTRHGVYSTAPGTARLAPAPCPTALLRLLTPPPRTHHPTPPATGEHGQGL
VQFVLAAHEGQRNTRLFWAACRAYENGIGPDLSPALIDAAVHTGLSEREARSTLASAARM
TGRRP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]