dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|433591386|ref|YP_007280882.1| (Natrinema pellirubrum DSM 15624)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Natpe_2149 [Natrinema pellirubrum DSM 15624]
Sequence length 42
Sequence
MEHPYGRCQHCGERLYAHIEGDYQCVNCDRRYTEADLETRAV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]