dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YBR013C (Saccharomyces cerevisiae SGD)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment YBR013C SGDID:S000000217, Chr II from 265879-265490, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, haploid deletion mutant exhibits synthetic phenotype with alpha-synuclein"
Sequence length 129
Sequence
MIYPLFRICILGAFLLGSYACLENSTQKGIEGVTLSHNSVQINNTLAKSAPFCESDALSM
NYSTENMLSNNACDYTKNSSYPYIITIITKAFDNALENSLNLQANRKLYHRVGTCIQNIF
YQLLLTVNY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]