dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YBR155W (Saccharomyces cerevisiae SGD)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CNS1 SGDID:S000000359, Chr II from 549765-550922, Verified ORF, "TPR-containing co-chaperone; binds both Hsp82p (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase activity of SSA1, ts mutants reduce Hsp82p function while over expression suppresses the phenotypes of an HSP82 ts allele and a cpr7 deletion"
Sequence length 385
Sequence
MSSVNANGGYTKPQKYVPGPGDPELPPQLSEFKDKTSDEILKEMNRMPFFMTKLDETDGA
GGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSIN
ESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATF
ANQRIDPENKSILNMLSVIDRKEQELKAKEEKQQREAQERENKKIMLESAMTLRNITNIK
THSPVELLNEGKIRLEDPMDFESQLIYPALIMYPTQDEFDFVGEVSELTTVQELVDLVLE
GPQERFKKEGKENFTPKKVLVFMETKAGGLIKAGKKLTFHDILKKESPDVPLFDNALKIY
IVPKVESEGWISKWDKQKALERRSV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]