dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|21220158|ref|NP_625937.1| (Streptomyces coelicolor A3(2))

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein SCO1662 [Streptomyces coelicolor A3(2)]
Sequence length 333
Sequence
MIELEGVPELVDPVMVAAFEGWNDAGDAASTAVAHLDREWKGEVFAALDAEDYYDFQVNR
PTVFMEDGVRKITWPTTRLSVVRVGGDKPRDLVLVRGIEPSMRWRSFCNELLGFAHELGV
ELVVVLGALLGDTPHTRPVPISGTTSDADLARRMDLEETKYEGPTGIVGILQEACTHAGV
PAVSLWAAVPHYVSQPPNPKATLALLNRLEDLIGVRVPLGELPEDARAWQVGVDQLAAED
TEVAEYVQSLEEARDTAELPEASGEAIAREFERYLRRRDGAGPGGPGGPGGHATADGGDG
PAGAPFRRDNPSGRARPPKPPKAGGDDEESSED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]