dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Physo1_1|131927|estExt_fgenesh1_pg.C_180036 (Phytophthora sojae 1.1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 623
Sequence
MDMEVLRFPLSSPSARAPANANVWERLLQTFAVPAPTAHRFLPKLKAGPLLLEVGQPPEW
KPFEVVLAGASAADLGLYYYPHKEDATPMGCIRLQSAHIDSLEEVLMVVAKDKTWFLCAD
HVRDASDWCDAICSAIERVSNRDGAATQHQLQERRRRLNSSASAVTLCELQSRGAKARVD
EFLEVFVRSTREDMCLQAAKGALSWSCMRSLAWKVWLECIPADVPFSQWVVIARDKRQRY
EKLRKKQNLFQDLLVGKQRPEDLLTMCETSTDSLLYSIYKDVRRTRGDMPYFRDPVVQCL
LIRVLYVYSATHSEISYNQGMGELLATLVYLLHIEQWPTDEDDIEEVIAGEHDAEPDGRL
SGSYFFPATSPTKEQAEDTSTEEEDTSYVYVESFINIQNDDSFLDRDTFLRLAPFAGGSG
RYYECCRDAAGEIVRELTASEFIEHDAYLLLEEMMLRMAGTYCPHVRIPRRNSRSEKPLS
SADQLPPSPLDDQMNRIHHHILSRCDPPTARHLAKLGVEPQIFLLRWVRVLMAREFETPQ
VWQIWDAIFSLTPSDFSFINLLCVAVVREFREEILAAEDATNVLLSLRDIADRIEPPRLV
DNARELYDALLIAAAVEASMGSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]