dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Physo1_1|134696|estExt_fgenesh1_pg.C_330086 (Phytophthora sojae 1.1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 862
Sequence
MEGVLWTREGRSKLLRGWHKRYFVLSECGTLREYASDVSKKELLQSRSRRASSGASTTSS
TSSPERSRSISSLNSSGMMLRRELDVRGAAVKTLPFPLVGRHNAFQVTITARPVSSQSGA
GEAADDAATSATKLVLSARQADDVRQWMGAIRSAALKLSIPRRPLSPMGWSRGSDSRASE
GNLESDFLDVRMPQRADMALLSSVYEWIHECCVKTSQNLTVAGVHVPRGSLLVSANGVSL
QTLTSVEVRKLLLESTGPLPVSLRFLRSPAKCGVLRAKLYTSPLTQLKSLARYRKSSRMD
WKEQVVDLSGDLLTCQLKMKTPVAIGNSKKSSSSGSKTKRVLLLSSGSCVKPVHELVSDR
KFCFIVTVQSHSMLFQARSEADRRAWTDAIQRAITIAEGLVPGGALARGSFDLDALQLQS
SMNMRHLDQAFEGMEEGNGAVDFDDDSDLSDEDVEEELSPMDPTPSFPSDKDWASATQSG
AYLPDRELSEMLRVLQSSGRFIEALQLMQKNTTLRSKYWRQIFRWALIPARSDEENKKLF
QQLINTSLAEEDDLQVQKDIPRTAKWLAGSAGAPKLDEISPSSTSSPPSSPSFYMQGMNG
LAFILLEVLENDEVEAFRFLRGIVARILPHVFGICCEGTGRDHFDLFRSLVEVGDVLQEV
ARLHLPNFHAALDSAGLPVCLLAYKWFPTLFSDVTLTASHSQLRFDTLLCCWDVCLLLGL
EGMFCVALALCSAAEDDVLALAACGEAVSHSAEQVSATVGRALALLSPEDLVTSVCEVLE
LCSHPVLLKLRNAHRRRLKLGYSKVGNGFAASGTRSSPDRTVAKTPSTSTPAPPMTVTDL
DSGKVFKISTSGNMLLPTAAPQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]