dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|82544819|ref|YP_408766.1| (Shigella boydii Sb227)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chaperone [Shigella boydii Sb227]
Sequence length 250
Sequence
MFNLTNTAKIVVPALALLATAVSFSSHASVTPDRTRLVFNESDKSISVTLRNNDPTLPYL
AQSWIEDAKGNKISSPLAVLPPVQRIDAMMNGQVKVQGLPDINKLPADRESVFYFNVREI
PPKSNKPNTLQIALQTRIKLFWRPKALENTSMKSPWQHKVTLIRNGQDFTVNNPTPYYVI
ISNASAKKGGNPPAGFTPLMMEPKTSAPLNAKMDSVPVLTYINDYGARMPLYFKCTGNSC
QVDEEQSRKG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]