dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

479433.Caci_0136 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Catenulispora acidiphila DSM 44928)
Sequence length 622
Sequence
MKNTNTRRRAAAAGAAVATMAAGFGLLAATAQTAQAWEINPASCKHAPHSHKHGVQPTET
QTLCDRINAAGHAAPTGSETLSYGGGVDGIGVNSGKNQVYLVFYGSQWGTQTAGSNGVSS
FSGDPKGAAPAAQKMFKDIGTGGETWSADLTQWCDGPNVAAGATSCPSNAAFVPYQSGGV
LAGVWYDNSAASPAKASGHALGVEAVNAAAHFGNTTAASNRNAYYVILSPTGTNPDDYEN
PSTGYCAWHDYNGDTTLTGGAVASSYGDIAFSNQPYNIDAGQTCGTNFVNSGSAGTLDGY
TMTLGHEWHEMMSDKNPAGGWTNNTGSSYNGQENSDECAWLKPGTTGGAANVTLGSDTFA
EQASWSNDTNGCAMSHQILTHNGGGAVTVTQPAAQTSTVGSAVSLQIQASDSTSGQTLSY
TATGLPQGVAINSASGLISGTPTTAGSSSVTVTVKDTTGASGSATFGWTVNSTTGGGTVI
TNGGFENGSLSGWTTSGVTAATATGPHAGGYAAELGNLNPSSTSTIAQTFTAGAGNSRLA
FWYNVTCDDTVQYDWATATLKDNTTGTTKTVLAKTCTNPTSGWKQVTAAVTAGDSYTLTL
SNHDDNYAGDPTYTLYDDVAVS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]