dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

523791.Kkor_2257 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Kangiella koreensis DSM 16069)
Sequence length 618
Sequence
MKLNQVVAGVLLATGVTGAYAGEFQAAAQPEKAIKGQYIVVLKDDAVAANMGLFSSNASE
QAIAMVSDNLSRKYQAQVQRTFTKAVKGGVFNMSEKAAQKLAQDPNVLIVEEDQIVSINA
TQNNATWGLDRIDQRNLPLSGSYTYNTTASNVNAYIIDTGILGSHSEFSGRFMGGYDFVD
NDSNPNDCNGHGTHVAGTVGGSTYGVAKGVKLYGLKVLGCNGSGTNSGVIAGIDWVANNH
VKPAVANMSLGGGASSTTDNAVANLVASGVTVAVAAGNDNSNACNYSPAREPSAITVGST
ASNDSRSSFSNYGSCLDIYAPGSNITSAWSNGGTNTISGTSMASPHVAGVAALYLANNPS
ATPSQVEAAIEGAASTGKVSDAKSGSPNLLLYSLFDGSTPDPDPEPQPGNELENGVSVSF
SGASGSETDFTFQVPSDASNVSFDMSGGSGDADLYVKFGSAPTTSSYDCRPYRNGNSESC
DFSAQTGTYYVMVRGYTSYSNVNLVATHDGGGSTEPPPEGGSARLDNLSGASGSFTHYYV
DLPAGMSSLDVQMSGGSGDADLYVRKGSQPTTSSYDCRPYRNGNNESCSFSNPAQDRWYI
SIRGYTSYSGVSLQVDWQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]