dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

59729.ENSTGUP00000012926 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Taeniopygia guttata)
Sequence length 439
Sequence
RILTAFTLAVCLSSPGKAQQQCTNGFDLDRASGQCLDIDECRTIPEACRGDMVCVNQNGG
YLCVPRTNPVYRSPYLSPYSNVYPPPPAPGPVPNYPTVTRPLMCRFGFQLDENNQCADVD
ECASDSHQCNPTQICINTEGGYTCSCTEGYWLLEGQCIDIDECRYGYCQQLCANVPGSYS
CTCNPGFTLNDDGRSCQDVNECTSENPCTQTCVNTYGSFLCRCEPGYELEADGVNCSDMD
ECSFSEFLCQHECVNGPGSYYCTCPSGYNLLDDSRSCQDINECEIRNFTCTSQQTCFNIP
GEYKCLDPVRCEEPYLQINENRCMCPAENPGCRDQPFTILYRVMDMVSGRSVPSDIFQMQ
ATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPVKGPRTVELDLEMITVNTVI
NFRGSSVIRLRIFVSQYSF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]