dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

69293.ENSGACP00000002201 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Gasterosteus aculeatus)
Sequence length 1537
Sequence
PNVCVEREVTLVAQRQPCVQAFTRMVKVWKQGCAAQSWCMGYERRTAYYTAYRQVYRQDY
QTVHKCCPGWSQLNGEAGCLYHVNECEETNGACEALCCNTIGSYYCRCPAGQKLNEDGKS
CQDIDECQVHNGGCQHRCVNTRGSYYCECHPGSRLHVDGRTCLAVHSCAVSNGGCEHYCM
QQSAAHFRCRCKANYVLAEDGKHCKLQNPCADQNGGCVHECRADGGKAHCDCKAGYILAE
DGKTCQDVDECEKEADCAHGCRNTLGSYACVCNAAYELGSDGKHCYRIEMEIVNSCENNN
GGCSHHCQHSTSGPVCSCNHGYRLDDDLKTCADVDECGEQSSCCEQDCTNYPGGYECYCS
AGYRLDNDGCSCDDVDECLASNGGCDHTCQNSAGSFQCFCRRGFRLDEDRQSCIPLEDAI
EALSSGAAIELPLIQPLLTLMQDYNQPLERYDDYEDDDGELRAESNLAEKFVCLDDTFGS
DCSLTCDDCSNGGKCNSWKNGCDCPAGWMGVVCNQTCPEGYFGKNCSFPSKCKNGATCDP
ITGSCRCPPGVSGDVCQDGCPKGFYGKQCNKKCNCANNGRCHRTYGACLCDPGLYGRFCH
LPCPKWTFGPGCSDECQCVQQNTLQCHRRHGTCVCKSGYQGNTCEEECKPGTYGAGCAKK
CSCPLGVSCNHVTGACQRKCPPGRHGENCDQDCPVGRFGAGCVHPCNCTGSPCDKVSGRC
KCPAGTAGKRCENLCPDGFWGSGCTETCPACENGGVCDKHNGSCNCPSGLMGRLCQNSCP
SGRFGQACQMKCVCENNARCDPVAGRCTCAPGWTGHNCRKGCDAGHWGEDCAETCDCRNG
DGSCDGVTGQCNCEAGYTGTRCHQKCPAGMFGLGCRRRCQCDNNALCDHVSGACTCQVGW
TGTFCEKPCPPGFYGLDCQEKCSCLNGGSCDHVSGLCSCPAGWIGSSCDLTCPTGFYGEG
CNQTCSCRNDGICHPASGQCVCTPGWTGPNCTEECPPGFYGGDCQQRCLCQNGATCNKST
GKCSCASGWTGTACELAGRFGRDCQQQCECENGGQCDALTGRCSCSGGWVGGRCERACEA
GLFGAGCEERCRCVHGDSCHHVTGACRCLPGWRGKLCDKACLPGMFGEGCMHHCACAQGT
SCHHVSGDCGCPPGFKGNGCEQTCLPGTFGQNCNQVCRCSETNQLCHPVSGLCYCAPGFH
GRRCDQICRKGRYGLNCESECQCENGGRCIPSTGACDCPAGFIGASCNITCPAGRYGVNC
ARVELCGDGAQNDPVTGRCKCVAGRRGSDCAHGCLPGWFGAECVERCNCSNGGVCDSVTG
GCMCSLGWTGSHCNKECPEGRFGANCQLKCNCQNNSTCDRVTGTCRCGPGYYGQLCEHAC
PPGLHGPLCQLQCDCMNGASCHPASGACVCPPGYHGARCHRVCEQGTFGHGCANVCDCEE
DSPCDPVRGRCLCSSGRTGLKCDIECRENRFGPDCAETCQCGNGSQCDRRNGRCSCLHSW
IGLTCQEGTVDLHASPTAGEETRSMRTRYSTGADFFY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]