dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

7460.XP_397194 (STRING v9.0.5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Apis mellifera)
Sequence length 1274
Sequence
MAEVVQMFLFLYKSKYRRKGQCREVVRDQCGVIAVPWPILWAALICWVVHVTAAASSSSS
SLTTDTTCDTDSCVNGDCVNGTCVCHEGWQGSACQFCGGKVKLTEPTGNIHDGIGNYTAD
VKCSWLIESSPNSTIRMHVEQFATECGWDHMYIYDGDSVEAPLLAVFSGLMHKDGYHIRR
VPEVIARSGSALLHFYSDVAYNMSGFNISYKINACPSRYSHIDCSGHGVCIDGVCTCDAT
WTGEACEIQVCPNNCSHSHGQGECNRESHHCDCVHGFKENWIIIDRGFWESVFYTDFSPE
GSASHCSIVWKDSLYIVGGESFHRAKMIYVYDFNGNVWETPHVEGKVPQPRYAHSCILFG
DKIFMYGGVLPNSTVTNEIWAFDVSAKVWENVTVHDNSNKTMRGPLKVAGHSATLVNHGR
KEKMVVIFGYSPQYGYLNEIQEYYLGTREWQIVDTIGFPVKGGYGHSSAYDALTNLIYVY
GGYVSESQTTQVLTSRLYSYDPNFRQWTLLTAAPSARFFHTAVFISGGLMIVFGGNMHND
TQHSDGTRCYSADTIAYDVTCDSWHQFPMPKEMTDLPRYGHSATVFEKSMYIYGGFDGQM
LSDMTRYTPGNCEHLTNQNHCLNARTGVKCVWDKRENRCIQITKISRHVLLNDDMHDGIY
MRCLDDTPPRGMTSHKELCKLLTDCVACVQTSYNCIWCGKSCSHEICRDNANAPPTKAIS
DLEQCDAHTAIKCLQLHTCHACSSNPHCIWSWSNGPDRCKPYSKAREVIVLQDSCRSPCV
DYTSCKNCTESDCIWCQNEKRCVDKNAYPASFPYGQCREWTTVDSKCHPTETGKEWCTFY
SSCAACRSDPGCGWCDDGSGTGKGLCLPGGARGPSTKSLDTCSIERWYFTKCPTCQCNGH
SKCLSNSSICIQPCGNLTYGPHCDKCIPGYYGNPLNGATCQPCFCNNQGTQCTSETGKCF
CTTKGIIGDHCERCDVSSLYHGDPTNKGSCFYDLAIDYQFTFNLSKKEDRQYRAINFKNS
PPKPDIDAEFSITCSVLAKMNITVKRANTPEMPVILGANCTTSMYKHRFIKDGYGFGSEN
NNTLTTFYVYVYDFQPPVWIQISFSQYSKLNLQQFFITFCTCFLALLLVAAVLWKIKQKY
DMYRRRQRLFVEMEQMASRAFSQVLVEIERRDIDNSDSERSESELVNCRKKKKDAPSPIA
LEPCCGNRAAVLSLLVRLPTGGEPYTPAGQSAGLAVASALVTLGSPRRPSQELTTKEPTK
TRKSASQHPDSTCI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]