dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTBEP00000010641 (Tupaia belangeri 69)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:TREESHREW:GeneScaffold_85:31566:46996:-1 gene:ENSTBEG00000012283 transcript:ENSTBET00000012286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 774
Sequence
MAKTLSDSLLFTLEELVPYDFEKFKFKLQNTSLEKEHSRIPRGQLQTARPVKLASLLVTH
YGEEYAVRLTLQVLRGINQRLLAEELDRVISQEYLTQDGGGTDSSAVSCSSGENKQKSLK
IVDGPRGDGAASLLCSQLEAGKGSQKKTQSKRREQKVLEGLDAQGKPWPKNAALLSRRSP
TLGKPQGEKESLVSASLRRNASSAGRLQGLANGSLGRKEARKLEVDLPSGKKRPKSLELT
ISPGEKELPGSKALLTLQDTRSAGPDLVATPREPRAGVARTIVALEKGSKNLEHSVWRRP
PDEAACSLCHAQEGDPAGGTCMHNSCSCPITSGDPETSGSHSTICLRCQASLAKGSPRDL
SPQPLPQCQRHMKQVQLLFCEDDREPICLICRLSQEHRGHQVRPIEEAALEYKEQIQKQL
EHLKELRKSGEEQRAQGDKNMANFLRQTETQKQRIRCQLEQLCRFLEQQEQLFVSWLGEL
GQTISQAREKYGARVSRDIALLDKLIGELEAKQGQPEWELVQDVGVTLHXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XISFYNVTARSHIYTFTGFSFSGPLQPIFSPGTHDGGKNTGSLSICTVGSHGSH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]