dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CmR10 (TargetDB )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment $ NESG $ SQ141696 $ PDBT145864 $
Sequence length 630
Sequence
MRKLRKLLLFSTVLFVVFTQLFGFIITVDAAETATINLSAEKQVIRGFGGMNHPVWISDL
TPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVFASPWNPPSNM
VETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWT
PQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNM
PYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIR
RSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSAYKNKKDNSVVAVV
INKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFVG
GGSSEPQIPVERNAFSKIECEEYNATNSSTVQVVGTGTGSGLGYIENGNYFAYKNINFGN
GANSFKIRAATTGTPKIEIRLGSPTGTLAGTLQVAATGGFNAYEEQSCSINKITGVQDVY
LVFGGAVNVDWFTFESKQEPTFKYGDLNGDGNVNSTDSTLMSRYLLGIITTLPAGEKAAD
LNGDGKVNSTDYNILKRYLLKYIDKFPVES

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]