dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F22B7.7 (TargetDB )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment $ SECSG $ SQ49300 $ PDBT3826 $
Sequence length 320
Sequence
MSDQLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWC
ILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCHSHG
MGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLM
PRRDGYMYIILLYIILGLAITTMCIDLVGVQYIRKIHYFGRKIQDARSALAVVGGKVVLV
SELYANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRYIDQTADAATISTSSSA
IDMQSCRFCHSRYSLNRAFK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]