dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HCDG_06389T0 (Histoplasma capsulatum H143)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | HCDG_06389 | Histoplasma capsulatum H143 kelch repeat protein (657 aa)
Sequence length 656
Sequence
MGKSDKKSKTAEKKARVAAKQSKKLAQKEKKLKAKGQADDSDAEDVDLDAVLAAYAEEQA
KFLKVTEVSCGPPSPRSSSTLIASPARRSELFLFGGEYFDGTIATFYNNLFVYQADKHEW
REVTSPNSPLPRSGHAWCRGGNAGEFSSPKQGTFYHYNDFWHLDPSSREWSRIETKTKGP
PARSGHRITYFKNYILLFGGFQDTSHQTKYLQDLWIYDCQKYTWHNVILPPASQKPDARS
SFSFLPHEFGAVLYGGYSRVKMSAAANKQQKGGAQRMILKPIVHQDTWFLRITPPPSDAP
STAMPTIRWERRKKPANPPNPLRAGATMAFHKGRGIMFGGVHDVEATEDGIESEFFDSLH
AWNTDRNRFFQLALRRPRATGKKQQAAMKTEKRSRGKADEEDLLRNLALVETKAIESQPM
DIDSPENEDEDNGEKRNLTVRFEMPHRRFNSQLTVLDDTLFIFGGTFERGDQEFTFNDMY
SIDLVKLDGVKEIFYNEPEHWNDAIPVDTDEEDEEEEESDDGENEDIEMESVEVASTAAT
SVTEPAQMETEVEQESETPAQDSRPHPRPFESLRDFFNRTSSEWQDILICKMNTAKSGSE
MSIKELRKEAFALAEEKWWDCREEITALEDEQEEAGIGEVVSMADRSDVPTAGRRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]