dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HCEG_00542T0 (Histoplasma capsulatum H88)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | HCEG_00542 | Histoplasma capsulatum H88 conserved hypothetical protein (1149 aa)
Sequence length 1148
Sequence
MAGTGSERETGKPVEGSSPTKAVAEPPTPAIPPPPLTPDTSKRFTSVIKYFRSSKTRSTT
ISTTWPSRRFISKNSAKPPSEESSHNKISEALRLATPTTSKSPDLDLFRSPSLPVPAAVL
EPGLRQNIELERRFLEYQEPRETAHRKSSLPFLEPVVADSVPKSPLRTEAPFVKAFFESP
LVPSSNNKKADTSSQPTESVLKAMTSNNPIGGQYDSFQEQNAGPSTTTGNLTAQSPLPNG
QNSSSTPTNLSGLVCNVHRTTGREPRPLVGPSSTVLGDKLYVFGGRVQSRSRPELLTNEM
YELDLVRRHWTKLETTGDIPPPRYFHTVCALGDSKLVCYGGMSAKAALPNQPPATPNQTS
QRSGEEAQQGVVLLSDVHIFDVPSRTWIFIPTANAPRGRYAHCATILPSGATFGSSNAPI
SALHHNPSSSNPHQGTLGVEIDGYGGAEMIVVGGQDTSNHYFEEINVFNLRSLKWTSTTS
LDRSCGAYRSVATPLLGVKPSDIGGGVEVEGFRDPTKPDAQKPDPLLLIYSNYNFLDVKL
NLQLRTSDGKLTEKSMNGTVSPPGLRFPNGGIINGHFVVSGTYLTSSKQEYAMWALDLKT
LTWGRIDAGGAIFSHGSWNRGVLWSRRSTFVVIGHRKRSLVEDYNHRRINFSHICFVELE
AFGLYENPRRSAPTSGYVSVSSPMVPASLQAKISQQGAGGRPLSTTAEELGRMALSLREL
SDMELLTIGGERIPVNSHILARRWGPYFIQLLRESTIAEENMSDAATVRQQTSSHPSRNS
SITITPSVGNNSSYSAATTLIGHTGSSSNQKTPPSLLPNLEIPSAHTLTPTSRPRTLYLP
HTHLTVQLLVHYLYTSSLPPPGSQLCTPQILCSLLQLARPYQVDGLLEATVERLHQVLDG
RNAAAVFNAAAMAAGGGRGTGFASGPGGTLEVLNGVHSRSNAVASAIEPMSILNLNSNSD
TESGDTSGPRSGTVGGGPGQSQRRTPSAQRPANLRINTTNLNTGNAPGGFSAGGNRNRAE
SVSSAASTATSASTNTSLSFSESMGVDDIARHNDPNNKNKDDDMVGHERGRSKPEREIWT
GEISSVVGLQKRGLRGLMEGRRMRERGGRPANLPGAAGVGGEDGNSTDTGGAPPAISAAP
AGVAVGSG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]