dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|22297974|ref|NP_681221.1| (Thermosynechococcus elongatus BP-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ATP synthase F0F1 subunit C [Thermosynechococcus elongatus BP-1]
Sequence length 99
Sequence
MISGNFVLSYYVSRKSTMNPLIASASVLAAALAIGLASLGPGLAQGNASGQALEGIARQP
EAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFANPFAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]