dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|22298729|ref|NP_681976.1| (Thermosynechococcus elongatus BP-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoketolase [Thermosynechococcus elongatus BP-1]
Sequence length 812
Sequence
MVSSPPRPTALTDDIHAFGPARATIQGQPLSDSEVEAMDAFFRACNYLAVGMIYLLDNPL
LKEPLKPEHIKKRLLGHWGSSPGLAFCYLHLNRIIKKYQQEVIFLAGPGHGAPGVLAPVY
LEGSYSEIYPNISEDAAGLKKFFKQFSFPGGIGSHCTPETPGSIHEGGELGYVLSHACGA
AFDNPDLIVAAVVGDGEAETAPLATSWHINKFLNPARDGAVLPILNLNGYKINNPTILAR
IPHQDLENYFRGLGYDPCFVEGSDRPSMHQAMAATLDYCVTRIKEIQRTAREEGLTTLPR
WPMIVLRTPKGWTGPAEVNGHKVEGSWRAHQVPLADVHTNPENLQLLENWLRSYRPEELF
DHNGTFRPDLKALAPTGNYRMGMNPHANGGLLRKDLKMPNFREYGITFDKPGQIEVENTR
PLGVFLRDVMRNNPRNFRIFGPDETTSNKLNAVYEASKKFWIAESFDEDADGGELSPEGR
VIEMLSEHTLEGMLEGYLLTGRHGFFSTYEAFVHVIDSMFNQHAKWLSICNELSWRADVS
SLNLLITSTVWRQDHNGFTHQDPGFLDIVCNKSAKVTRIYLPPDVNSLLSVADHCLRSKN
YVNVIVSDKQLHLQYLTMDQAIIHCTKGVGIWDWASNDQGYEPDLVMASAGDIPTQEALA
AIALLRQEFPELKIRYINVVDLFKLQPETEHPHGLSDRDFDSLFTLDRPIIFNFHGYPWL
IHRLAYRRHNHRNLHVRGYKEKGNINTPLELAINNEIDRFSLAIDAIDRLPELQVAGAHA
KEKFRNMQIAARNYAYEYGVDKPEFSHWTWPF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]