dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

SPU_003986 (Strongylocentrotus purpuratus v3.1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 355
Sequence
MFIFQLDAEFRRFTINPNKVGTYEDFYAFLERMHHLGDVPFLVGYTDPQGDLLPINNDDN
YLKALTSSKPPLKIVLQKRDEVSEGDIQYGSTIPRRKNKISQYLQASQSPKPLKPFKNIG
LPQDFRRVSAIIDVDIVPETHRRVKLHKHGSDKPLGFYIRDGTSMRVTPHGLEKVPGIFI
SRLVPGGLAESTGLLGVNDEVLEVNGIEVSGKTLDQVTDMMVANSANLIITVKPANQRNT
LSKKKQQHLGVSSSLSQSMASLGSLDELSDEDEVQDHSEKPAETGGDGEEKGKKTEETKS
EKMEMREHHGEGDVEITREKKVPSEKILSQSSEKIKQPPDDSETNAISDNEECTL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]