dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTTRP00000004325 (Tursiops truncatus 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:turTru1:GeneScaffold_3612:141798:203510:1 gene:ENSTTRG00000004613 transcript:ENSTTRT00000004591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 898
Sequence
SRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESL
LEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYL
ESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAK
XXXXXXXXXXXXXXXXXXXXXXXXXXXMDEFGQPNDNPQLAHVEAVCIAWTMEYLLRFLS
SPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL
ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWW
ATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAI
KRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKTGESANTKDSTGDNRLSPSRWKW
ARKALSETSSNKSYENKYQEVSQKDSHEQLNNTSSSSPQHLSAQKLEMLYNEITKTQPHS
HPNPERQQQPERPSAYEEEIEMEEVICPQEQLAVAQAEGIVDMKSTSSIDSFTSCATDFT
ETERSPLPPPSACHPQMKFPPDLARIEEHQRARAPPFLTLTREKMPAARDASPEYAPIDV
TVNLDSSGSQGGPHGPSQSDSAAESPRSSLKGSNPLKSGSLKVNFKDNRGGAPQTPPSTA
RPLPVTAADFPLTTPQLISTILLEETPSQGDRPLLGAEVPAHCQGPSKGLTPRFPKQKLF
PFSSRERRSFTEIDTGEDDDFLELQGTTRQDKQADSNPNCFADKPSDGRDPLREEASVGA
SSPQDTSHNCRQDIYHAVAEVKKDTSQEGCKMENHLFAPEIHSNPGDTGYCPTRETSM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]