dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTTRP00000005242 (Tursiops truncatus 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:turTru1:scaffold_82657:11332:18180:-1 gene:ENSTTRG00000005556 transcript:ENSTTRT00000005556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 616
Sequence
DLVTFKDVAIDFSQEEWEWLNPAQRSLYRSMMLENYQSLVSVGLCVSKPYVISLLEQGKE
PWEMKSEMRRTPFPDWESVYETQELPLKQFVCDDVLMGRIISYGLECPTFGEDWKCEDLF
ERQLLSQETFIRQETITHKETLTVEIDHKYNKSGKFVSLDNIEENIYNHKSDKKSFSKNS
MVIKHKKVFVGKKLFKCNECEKTFTQSSSLTVHQRIHTGEKPYECKECGKAFNQSQHLAQ
HYRIHTGEKLFECKECRKAFSQNVHLIQHQRIHTGEKPYKCKECRKAFSQPAHLAQHQRI
HTGEKPYKCKECGKAFSDGSSFARHQRCHTGKRPYVCIECGKAFRQNTSLIRHWRYYHTG
EKPFDCIDCGKAFSDHIGLIQHRRIHTGEKPYRCNVCGKTFSYGSSLTVHQRIHTGEKPY
ECDVCGKAFSHHASLTQHQRVHSGEKPYECRECGKAFRQSIHLASHLRIHTGEKPYKCKE
CGKAFSISSQLATHQRIHTGEKPYECKECGKAFKQRAHLAQHHKIHTGEKPYECTECGKA
FSQTTRLIQHQRVHTGEKPYKCTECGKAFSDSSSCSQHRRLHTGQRPYECVKCEKAYRKK
SLLICHQRCHTGEKPY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]