dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTTRP00000008542 (Tursiops truncatus 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:turTru1:scaffold_116120:24319:29063:1 gene:ENSTTRG00000009008 transcript:ENSTTRT00000009006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 415
Sequence
MASTLSTSGAQPVLFEDLAVYFSEECVSQHPAQRSRSRXXXXXXXXXXXXXXGEGKIEIN
QKLRLESMGLEELALEKYSIAVPLVYYPEKSSEHGVGNLERKMSGRTPACKKSFISLLVT
IENHTPLIELSQCLGTRALSEILEFPGEEAKNSYKCPECDQSFSDSSYPVLHQKTHSGEK
KYKCGDWEKIFNHRANLRTHQRIHTGEKPFKCAECGGSFRQHSHLSRHMNIHVKEKPYTC
GICGRGFLWLPGLAQHQKTHTAKKACGKYFGQKTNLALPEKRHGSASRHPCSLSRKCFGQ
PSHLALPEWGHEDNPEHCSDCGENLLSFSKFEPLKRPECSLTFLRISELISHQSIHRGEK
PHKCKPCAECFILDSKLACHQKNHTGEPFKCTMCGKSFRLKTHLIVHQQIHAQNT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]