dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A024WX68 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A024WX68|A0A024WX68_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW51787.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_00212 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence length 272
Sequence
MNILCILSYIYFFVIFYSLNLNNKNENFLVVRRLMNDEKGEGGFTSKNKENGNNNRNNEN
ELKEEGSLPTKMNEKNSNSSDKQPNDISHDESKSNSNNSQNIQKEPEEKENSNPNLDSSE
NSSESATRSVDISEHNSNNPETKEENGEEPLDLEINENAEIGQEPPNRLHFDNVDDEVPH
YSALRYNKVEKNVTDEMLLYNMMSDQNRKSCAINNGGCSDDQICININNIGVKCICKDGY
LLGTKCIILNSYSCHPFFSILIYITLFLLLFV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]