dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A059C598 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A059C598|A0A059C598_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW73522.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_E02039 OC=Eucalypteae; Eucalyptus.
Sequence length 182
Sequence
NTKEVSHPRQEILPAQLKRKSTASLTDAESLIVEKKAKCKRTQKGKKEASGCDAEEVSTE
LTLLFDPYKIKKRLTQSDLGHMSRLLIGRDSVKSQFLRWMNEETVRQVESSKGADVIVRD
MDTCSEHRLVFVFWASSGSYVLKGGWIKEFVKRRDLAVGDEIGIYWEPIASKFHFSLLHK
VN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]