dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A067G5X3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A067G5X3|A0A067G5X3_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO70972.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g027710mg OC=Citrus.
Sequence length 179
Sequence
MLYVLIFAGPGAPAVCNCVVEIGKGGKVKYELDKASGLIKVDRVLYSSVVYPHNYGFIPR
TICEDSDPMDVLVLMQEPVLPGSFLRCRAIGLMPMIDQGEKDDKIIAVCADDPEFRHYKD
IKELPPHRLAEIRRFFEDYKKNENKKVDVEDFLPAEAAIEAIKYSMDLYASYIVESLRQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]