dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A077TQS9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A077TQS9|A0A077TQS9_PLACH) Serine hydroxymethyltransferase, putative {ECO:0000313|EMBL:CDR15470.1} KW=Complete proteome OX=31271 OS=Plasmodium chabaudi chabaudi. GN=PCHAS_132310 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence length 484
Sequence
MKIVKELCKKGKVKWRRYISSQSLQNYNSLKNVDEDNYNILSTYKNKSYLNLSVCNNVIP
KYVHDCLVNNLNKNVTLNLEHLKIIEDRALAAFNLENKYWGCVFNTSSHSECTNSMDEYF
LLKLFRNFVNYQSKIMIISFTLLDKETHEENNKEENRTDKNVLNEFYNILYIKNNDKINY
MEIKNQYEQFKPDLIYIDETNNPYNFDYEFITTLRNMKSKINNNVNSEKEGVEDKSNTLV
MTNISNKASFIIEKFISSPFSQADIVFSYLNENIRANNCYIIFYRKGFKNISTQGKLICY
EYEEKLKKTFFQNNVNNIICSLSTSFKCIQNHEFKEYIHQINKNINVLFSYLNKKYFNIH
FDQNNNFLNIACSNSLFNIQEYHMFCKKINILFDIININKSIYPQKSFNIGTNYLTALGM
EEHDMKYVSEFINQSILLYLYTKQKSANSNLTFLEYLENNFISSDILALSNDIHSFVSMF
PSPS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]