dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A086QL37 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A086QL37|A0A086QL37_TOXGO) Uncharacterized protein {ECO:0000313|EMBL:KFH13319.1} KW=Complete proteome OX=943118 OS=Toxoplasma gondii MAS. GN=TGMAS_258170 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence length 408
Sequence
MTDNAQTTSAEAGAANPSGEHPSAGAKRRQTLAAHELRDIQDGKAMDDVDQDSQPADDMK
QADAATLQKRQRLRIVRSAAAVPHPQGETTPGSPVTGSLSPAEKPVEAPKPSAEESASRE
TKDEQNAEGGKATNGVPENGKEGAGKSEKEQVGSSELLLGPAEIKSVQTFSSAFASLSKQ
PQSSFFLSPPQSNAGGETSGTPSLFASLASTSSLFSTSSVNKDNEDGADAEDEQKAEEPS
VIENEVDADEEILFTDRDCRMQRFDASQTAWAPKPPLEGRVQVSASKKPEDNGATRILFF
VHRTGRLQLNTPLFASANYQHPPDRSRQRAVPPRDEKPDDEKNGEEPLTEEMPKKRNTAQ
FLGLRTDAQSSSDTTIYRIRFSNEEKCAEFLSLANERKTKGKSQSTSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]