dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A091KJT3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A091KJT3|A0A091KJT3_9GRUI) Motile sperm domain-containing protein 2 {ECO:0000313|EMBL:KFP39465.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_12381 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence length 409
Sequence
WFRVKHHIRDPKQQLDKKKLVAFWLEHYAKRDHGKPLTVVFDMAETGISHIDLDFVRFIV
NCFTDYYPNFLTKIVIFEMPWIMNAAFKIVKGWLGPEAISMLKFTNKSDVQEYINGEYLP
PHMGGTDSFKYSYPPLVDDDFQTPLCENGPITSEDEHESKEEIKEEIDADTKETVELNEE
QNLNQKKMNSVEQISKSEETDKTEIKPKNAKKALTTFKGPLLHISPAEELYFGSKETGEK
KCLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCEPGTSLDIIVSLHGGFAASLQDRFL
IMAAEMDQSSGAGIPELTQFWKEVPRTKVMEHRLRCHVVESSKPSSLTLKENTFNIPAKT
NEDLHIQLTHILQINKRLQEQIDHCLWFQQLSVVLSLLSVIVVAFCFYL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]