dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A091T118 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A091T118|A0A091T118_NESNO) Uncharacterized protein {ECO:0000313|EMBL:KFQ49884.1} KW=Complete proteome; Reference proteome OX=176057 OS=Nestor notabilis (Kea). GN=N333_04478 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Nestor.
Sequence length 332
Sequence
CVSGCVCPHNQVLDGKGGCIEPEDCPCVHNGNSYTPGESIRVGCNNCTCRNRKWHCSDEP
CLETCSVYGDGHYTTFDGKRFDFEGDCEYVLIQNYCGQQGMNQGTFRVITENIPCGTTGT
TCSKSIKVFLGVSIFFNKFDGYSDVIQRTPGGKMPFQIRSMGIYLVVDTTVGLILMWDRK
TSIFIKLSPSFEGHVCGLCGNYDGNGNNDFTTRSQSVVGNVLEFANSWKVSSSCPNANRT
KDPCTANPYRKAWAQKQCSIITSEVFAKCHSQVEPNEFYEACIDDACACDTGGDCECFCT
AVAAYAQACNELDICISWRTPSICPLFCDYYN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]