dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A091WEK5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A091WEK5|A0A091WEK5_OPIHO) WNT1-inducible-signaling pathway protein 3 {ECO:0000313|EMBL:KFR13550.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_11298 OC=Opisthocomus.
Sequence length 109
Sequence
ELCHWPCRCPPVPACTPGVSLVKDGCGCCKVCAKQSGESCNEADICDPHKGLYCDYSADE
PRYETGVCAHLVAVGCELNGVHYLNGQPFQPSPLYKCLCVSGAIGCTPV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]