dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A093CA24 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A093CA24|A0A093CA24_9AVES) Mucin-5B {ECO:0000313|EMBL:KFV09142.1} KW=Complete proteome; Reference proteome OX=240206 OS=Pterocles gutturalis (yellow-throated sandgrouse). GN=N339_01665 OC=Pterocles.
Sequence length 322
Sequence
TECVSGCMCPDGLVLDGSGGCIPKDQCPCIHGGHFYKPGETIKVDCNTCTCNKRQWNCTE
NPCKGTCTVYGNGHYMSFDGEKFDFLGDCDYILAQDFCPNNLDAGTFRIVIQNNACGKSL
SICSLKITLIFEVGLELIITDGAEKNYKVDLRGGYIVIETNQGMNFMWDQKTTVVVHVAP
SFQGKVCGLCGDFDGRSRNDFTTRGQSVEMSIQEFGNSWKITSTCSNINMTDLCADQPFK
SVLGQKHCSIIKSSIFEACHSKVNPIPYYESCISDFCGCDSVGDCECFCTSVAAYSRSCS
RAGVCVDWRTPAICPVFCDYYN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]