dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A093Q2F4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A093Q2F4|A0A093Q2F4_9PASS) Mucin-5B {ECO:0000313|EMBL:KFW82831.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_01534 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence length 340
Sequence
TECVSGCMCPDGLVLDGSGGCIPKDQCPCVHGGHFYKPGETIKVDCNTCTCNKRQWNCTD
KPCKGTCTVYGNGHYMSFDGEKFDFLGDCDYILAQDFCPNNMDAGTFRIVIQNNACGKSR
SICSLKITLIFEVCLEWVITKEFEIRLLEGRIQEIATDPGAEKNYKVDLRGGYIVIETNQ
GMNFMWDQKTTVVVHVAPSFQGKVCGLCGDFDGRSRNDFTTRGQSMEMSIQEFGNSWKIT
STCSNINMTDLCADQPFKSALGQKHCSIIKSNIFEACHSKVNPIPYYESCVSDFCGCDSV
GDCECFCTSVAAYSRSCSRAGICINWRTPAICPVFCDYYN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]