dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A096N2M2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A096N2M2|A0A096N2M2_PAPAN) Sorting nexin 16 {ECO:0000313|Ensembl:ENSPANP00000006566} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=SNX16 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence length 315
Sequence
MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDANMGAASSIEYSTR
PRETEEQNPETVIWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFS
RLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVRE
FLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLE
NRIRTLSVEPEESLDVSETEGEQILKVKSSALEVDQDVLDEESRADNKPCLSFSEPENAV
SEIEVAEVAYDAEED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]