dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A098LZG4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A098LZG4|A0A098LZG4_9SAUR) Protein CYR61 {ECO:0000313|EMBL:JAC95858.1} OX=1550645 OS=Hypsiglena sp. JMG-2014. GN= OC=Toxicofera; Serpentes; Colubroidea; Dipsadidae; Hypsiglena.
Sequence length 376
Sequence
MNSQRTSCLILAFALLQLINRVVSSSCPDTCECPLEVPKCAPGVGLVLDGCKCCKVCAKQ
LNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSKIYQNGESFQPNCKH
QCTCIDGAVGCIPLCSQELSLPNLGCPNPRLVKVPGQCCEEWVCDDSKDNLEQLEGFFGK
GFDVDASEGELTRKNELISMIKRKLRILPVFETDIRSHSFENPKCIVQTTSWSQCSKTCG
TGVSTRVTNDNPGCRLVKETRICEVRPCGQPSYDSLKKGKKCTKTKKSQIPVKFTYAGCS
SVKKYRPKYCGSCVDGRCCTPQQTRTIKVQFHCDDGETFTKNVMMIQSCRCSYNCPHGNE
AYPNYQLFNDIHKFRD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]