dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D3HD92 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D3HD92|A0A0D3HD92_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART10G08740.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence length 414
Sequence
MPDVQPLVSEFVLKLKRRKVEGSHAVARQTAELLRSVVSQHRMGSTNQAAALADAVRGVG
EQLIAANPIELAVGNIVRRVLHIIKEEDISSTAVGIEGLSVTAESDDEYDSGNDDHPTLS
AAVLAAHARNALRAPSLQTLLEDIPVSTALSRSASSAGDSDGKSGDKSSKSRKLKHDVIA
AIGDLIDEIDTCYDQISEQAVEHIHQNEVILTLGRSRTVKEFLYAAKEKKRSFRVFVAEG
APRYKGHVLAKELVEKGVQTTVITDSAVFAMISRVNMVIVGAHAIMANGGVIAPVGMNMV
ALAAQRHAVPFVVVAGSHKLCPLYPHNPEVLLNELKSPSDLLDFGEFSSCMNFSTQDGTP
LLNVVNPTFDYVPPKLVSLFITDTGGHSPSYMYRLIAEYYSADDLVVRRKSTSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]