dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D9R1L4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D9R1L4|A0A0D9R1L4_CHLSB) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=LYZL6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence length 148
Sequence
MTKVLLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINGHYWCNDYRSHSENLCQVDCQDLLNPNLLAGIHCAKRIVSGA
RGMNNWVEWRLHCSGRPLSYWLTGCRLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]