dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0H3K2P4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0H3K2P4|A0A0H3K2P4_SYNP6) Soluble hydrogenase 42 kD subunit DHSS {ECO:0000313|EMBL:BAD79510.1} KW=Complete proteome OX=269084 OS=(Anacystis nidulans). GN=syc1320_c OC=Synechococcus.
Sequence length 382
Sequence
MEDKLMLMIPGPTPVPEQVLLAMAKHPIGHRSADFSRLVADTTAGLKWLHQTTGNVLVLC
SSGTGAMEAGIINFLSAGDRVLCCENGKFGERWVKLAQAFGLDVDLVQAPWGKPLDPEAI
RAKLEADTDKQIKAVILTHSETSTGVINDLETISGYIRAHGALSIVDAVTSLGAANVPID
AWGLDVVASGSQKGYMIPPGLGFVAVSDRAWKAYETATLPKFYLDLGKYRKAAQKDSNPF
TPPVNLYYALDAALKIMQREGLENIFARHAKLTRATRAAIKALNLPLYAADEVGSPAITA
VAPVEVAAEDIRSFTKKHFDILLAGGQDDLKGKIFRIGHLGFVSGRDVLTAIAAIEAALT
GLGYSNFTSGAGVAAAAAELAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]