dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0L0DFV4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0L0DFV4|A0A0L0DFV4_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC50208.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_06353 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence length 2822
Sequence
MHKPCEGYHVSLTPLTLEVQVYEVDAGRGRQVAAGEPQTVTLSPLATVLSACNEMALALD
GAVDGQNSSPHSPFQGWGLYRLIPDTDRDKDADESYGHLDYEATLAAAGVTTHTSLAFLC
RRVVVPVRIGPNGPLVSVPIDEAWSVYEIVDEIAAAHDSVLHPEEYSFCKADGHWLVGSL
SLPAQRAWSSLQTWPDAPAELVLTRKLYFIEAHAEALANLGPDAPDATLHLLYREASHLV
TSGALPVTEKEAILLAGLALQIAHGPRANAPPDALPQEPKDLACFLPPELAADVGAKLAR
KIARKHATFATTPRGLALSKYIKLVRSNPNYGWTFWPMKERVKAGRRFRLVPRLLGLSGS
GLKILNAKRSRELVVAAWLVIESVSGSDVGLGPSVVFNINNPSYADEPLVIVVESDAHVR
DIIGFCNDYVQLATRRSLASELVLTSCASLASLSQPSWDALVEPTSRRDADSERSEPDLE
ANHALPTHFTLNRLRGLDHAGSSSSVARSSSLSSLPAYVSEQWDSLLVAPQVDAYTSTTS
LFTTEFTTGSEEEGVLGRALQLQNAASASTFFTSGMYFLPLLDDAPPTMEKLRLSAKASL
AAALKPFSDLAATGKAALASGVSDGDEPSPSHALLVMAASGELARDALASLALALLELVM
AAAGDTTNLLLPEAAAASAELAFDALHELVARLAAFAGVAHLVRSQLPDADGAYAELWVP
ASQASGWRVPGELMQATELLEAASAAVCSVVADARAVLIAASHALHHMEELAPEAPPSRA
NTAAGAVVADAIAIPEEQTSALLTSGKRAGSAIARLATLLGVSPLAADLVDELDTQAQAS
SAAALALTNATAHDAFATLARTRASSLRVELNALPDLTRMLQRSVGIVSAAIKLGPVHHV
VAAKIKVASAVVSSTVRSLPHELPVNVPPLREAIISSLSAYQAAVDDVRPKVQPLTLTAR
DACLALINASAAVLAELPRLDGDAAALRKASLAVAGALASVGHCLRNAITILDSNGSHLV
LLKQLSAVSRLLVTANGLASQPAPPADQMSEVLVRASALGRWLHLDCDYVLATHDLKETL
AGSLVTAARLVVAEQAESDMHMTLGRDVSELRSDLARLALAPRSMRAADALFSNVSRYVA
HASAVVAAAAGAPTAELTAFSDSLARLAVLQQAAVQHSMAAMIAMYISDIDAARNRVCDA
LPSDEALDEPQTAGGEGSPTSGDMPAFSDSCSSDAFFASGSVADLLEALAEAEPGVDVHD
DDELLGSSTASLGAQADALVADIDSLLDQLGVESLAEAMDDDSVAISGSGTRASVAALER
ELAQSSSLAEAVGHYNATVSSLEASGAAVYAAARHVASLPNARARASYAARAAMDIHSAV
VDARLLVATVMAMWPKIYSQQAVARLKNVTLRFLSALGALLAVVRDLVSAVDGHVEERIA
ECKAAMATLKTAPPGLGMLSVLADELSEALDELRNPGVASSDTSDDGARSLDDIVDVAEQ
AVDAALRDGPGSIPRAHGGGGEQLGKTTAEQGFSELEAILRKCARLVTATLDELVTRPET
SLNDVEAGAQLVAQVMRALTTCVVGLRGTIQLAQEAPALRASLAALVSKVRTKVDDARAH
VLAGKGGLPGESVRDNAGPWMAAFDEFFAAFDAAVLAAQGSSGQTGLDVQRAVETATAGA
ARLEMSELGETERASDKRVASELRSVLDSSETMQATLNGMMPLVSWQGEASARSGTWPGL
DGKVPELAVQSAIALANWVEGTVRCVEVLGGVPAGVAPTPPSSPAGAQAPAPAVVPTRPV
WEAISSEFKAVMVALTTLKELADTPGAVARNVRAGYTQLVLAVRDILLVLKEGVVTDVAE
PGWLVKSEGEAKMLRKAGSALKTAAMKVVKHCDTQLKALRPTQPVAGVLKAKAFRKAFKA
TVSKLLAVKTAAEEIECVPAVSRGRLGGRGRAVPAFTSVTQVGERLLASGGQASWVLDLS
GDEVAALCELVCDGRVLARLGRGAALAVVDALASLKTLAEPVDAVVSVATACAALEHACD
MVDAVRGSVALLSPTTVGALEVLVQARQLLRAIEDATSASKTNAGAQLDAMMSAAADAFL
AEIDRVDDALGGYAEVVASGSMGVNFVAARAEVCEALGSVADVLGSGVCASRAQLRALSR
ELSTLVRDGVVPLVSCVLSSPLCADKECVSKAQAKSGEAICQVRKVFEADALALLDAHAW
RSSLIATMGKYVGDASEVDSSVVLPGLGYSDYVRKTKSHVVESVQAAQSLIDAAKCEQGR
LGVAARTLVEATEGVLKCVCGALSQTPASASDVLDAVRKASKTLAWTVARLVETCVDLAE
ASKADRASDAGRAAVISTSQRLVDAVSSLMCELKAGAVDAQRQRAALDASAALGSQLKQT
RLVLQSRSSGSASAGASEALGAAAEDALMIFLEEGVVETLGRAETEASVADALENAAKQL
ATAVAQLVELANAVETDVGSGVCKAGVEVVTAFCAAGADAAAHCGARQSSKRDAKLVSAV
SSRVMALVRAVRAASEAASRMSSEVTALAARVSSDVEALAELAALDDDGDEWCDAAAREQ
GAARVGAALRGLLDAIGQVWLGGASRSRASVLAAGHHVASRVEGVVSAMRASAAALGRDW
VLLSGEVWQAAEEAHEVVERLLESEVAASAAETAWAAVVSAMIVAASASRLDGPGDASMA
AVSVMEACAENVAGVSGDSEMSNLAHGAVGAVVMLTKVALLGLAEAEGLGFADGATREEL
AGCVRGVASALESLAFVAVASGETEEAGQAYSEAVNRVSAAVVKLISANNELVARGGACA
RR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]