dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0L8HVN4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0L8HVN4|A0A0L8HVN4_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF93254.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22004795mg OC=Octopus.
Sequence length 377
Sequence
MSLRSYSAFGSNFKNRHNFANSSNRSSYSSIHSYTKSEQYWWNYTDNAKGTNFQRAVSGD
KRPRFEDDTWDLADSLADLYLKVNEENIATASKFTVCKDPVNDIDVKKWIEEDTSHGFIR
VFVPNGNINSSRLVPCNLSTNTQRICAQCGVAHSSLHVQFNGDIIARMESTDHPLAIQNE
FLGNLGYTEPRKIQEEGYNPDLSYLIKFYLGKPVQDSTFTKAQLSSVILVRKGKLIYQWV
QRLCAISGTRLFIHRDKFPSSKKSIMQLAKGYVEEVKFKDHPNVLKLTITLHGERSIYLS
FTNTITYSKWLKRVQKATAKLPTKADLSKCNLEFLPDTIFINEDLRTLNLRHNVLKERPL
EEDIHTMGWLDDLPRYV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]