dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0P6IY20 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0P6IY20|A0A0P6IY20_HETGA) Low-density lipoprotein receptor-related protein 3 {ECO:0000313|EMBL:JAN96970.1} OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=LRP3 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence length 769
Sequence
MEKRAASGPEGAPGARAQLAVVCLVNLFLTGRLSSAVPAFAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQVSCQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYHSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGSSSEGDSGSSGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQVSVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPGPGATPGPSAPHTDAGSP
RAPGDGPPSAPGHTLELGPSVPLPSGLQDPEYRPMDRDRKACRDPLVDNLATVDTAPEPR
SAQDPQPQVPTASSTQGPHSAEPLGGCRSPLPPCSPMLEASDDEALLVC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]