dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0P9JGP3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0P9JGP3|A0A0P9JGP3_9PSED) Conjugal transfer protein TraG {ECO:0000313|EMBL:KPW46360.1} KW=Complete proteome OX=251704 OS=Pseudomonas syringae pv. berberidis. GN=ALO86_200270 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 888
Sequence
MKSLPPKQSRARSVVFAEGAQWIRADFHLHTRADREFKYTGDDNFYHSNYVDALEKASIR
LGVITNHNKFDLDEFKALRKTAQNKGIALLPGVELSVNDGANGIHTLVVFSDEWIDEHDH
INPFLTSAFEGKTPAQYEQENGRSSWSLLETIKKLESYHRDFFLVFAHVEAPSGLWAELD
GGRLTDLGQNEFFRRRTLAFQKVRTHDGAGKDKPCRTKIQSWLQSWYPAELEGSDPKGID
EIGRGKTSYLKLGELSFGAVKFALGDPAARVAMEPQKHKASHIRSIHFDGGILDGQTLHF
SSELNALIGIRGSGKSSLLEAVRYALDIPRGEKVQDTKYKDELIRHTLGSGGKVTLTACD
IYGQEFTISRIFREAPNVYLGGTLQPGVSIRETVLRSPIYFGQKDLSSTGEGFETDLVEK
LVGEKLRVLREAIETQRQRVCEAAQRWLKLSNIAETKRDFNAQLTDANFRLKKFEEYGVA
DKLQKRLGFQQDATALARMAERADDFILALGSLIAEHEDELRNATSYVSKQNPDFFVAYN
AEFSNLVAGVDQLKQIEQDMRAVAARLGTKQYEFEGASKSLQEEFAQVERQLAQELKQTG
MTAIQPDDFLAQQQRKTKAEQMLDALAKQESQQTTIRDALFAEIDKLNELWLREFTTIKT
ELDRVNAVNTALQIEADFKGDKEAAISFMQQLFKGSNIRETTLRAVMEDYADFGGLLRSL
PGALVKAGSAPEVFEKTFMQYLVEFSAWQVPNRFVIRYRGKELRHHSLGQRASALLLYVL
SQRQNDVIIIDQPEDDLDNQTIYDDVIKLLREMKPHAQFIFATHNANFPVLGDAEQVHAF
QYQDEKVATQSGSIDAHPVQEAIINIMEGGQEAFNRRKEVYNLWKLQS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]