dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0S6VRM6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0S6VRM6|A0A0S6VRM6_9BACT) Putative PAS/PAC sensor protein {ECO:0000313|EMBL:GAK49888.1} KW=Complete proteome; Reference proteome OX=1499966 OS=Candidatus Moduliflexus flocculans. GN=U14_01112 OC=Bacteria.
Sequence length 788
Sequence
MLSFFRRLSIQWKLAFSFMALSLFPLFGLGSMAYFTSQATIRQKVGFYSQKNLEQICQNL
QGTLEQIEKLSRLIVLDGKMSERLATFSTQTTLQKLKRTRDIEAELSALAISHPDVRQIL
LARRHEPLLASKESLLEKEQNYFSTDDFWQSDLYQEIARLRGQVIWKSGIRGKYTEFYLL
RQLIDPNTAQELGILVFVIKPDLLNRVLIQQTQSDGSQMFVIEQSAKIVAHSQASLTGTS
VTQTYLPEIFRDSHAGYFQTETALVVFSPLSNQWHIIWEIPLTFLFEEINRVGMIIVLAV
VVCGALAVALGLAISSVYSRIIRELVDSASAIANGELDHPLQLSGEDEIGQLAKQFATMR
DAIRQKIEALQTLNSELDMRVEQRTLELSAANAELARGQYILNCFMDNVPDGIYFKDRDS
RFFRLNNSFAAKFGVNDPALLIGKCDFDFFSEEYARPKYEQEQEIIRTGQPLLAFEEPDF
NGRWALSTKMPLRDEYGEIVGTFGISRDITPLKTAQKQIEDAYAEIQILNEQLKQENLRM
SAELDVARRLQMMVLPKPQELTQIPDLDIVGYMQPADEVGGDYYDVLHCQQGRVCIGIGD
VTGHGLESGVLMLMTQTAIRTLIDRGEIDPVIFLGTLNRVLYQNIQRMGGDRSLTLSMVS
YQNGQIRIIGQHEEAIVVRQNGQIERLDTIDLGFPLGMVADIREWVTEVNVTLQSGDGVV
LYTDGITEAQNAHNQFYGLERLCAVISANWRGASAETVKEAIIADVRAFIGNAIVYDDVT
LVVLKQTA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]