dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0V1CMM3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0V1CMM3|A0A0V1CMM3_TRIBR) Chordin {ECO:0000313|EMBL:KRY50565.1} KW=Complete proteome; Reference proteome OX=45882 OS=Trichinella britovi (Parasitic roundworm). GN=T03_6862 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence length 980
Sequence
MHRQKRFKQYNWKMLTAPVGFLEKSGSSRSLSLSWSAKTTVMAQYFNSAISSAIVTLLLI
NSFFHCIVILTVGGENTIDIVKPMIGLFPLKEHVDVRQKFLSKSNYTTINLGCYFGGKKY
ELDEEWNPDLGPPFGIMVCIRCKCIPIQKKKRIVGRVTCRKFVNLCQKPPCANPITLSGE
CCKTCPGMEVVPVDVFGSSHTQANDFHWNQGYHEFMALMTGPICGMSRSTGVGRAYITLD
RNMLHVSVYFERLEEIPITVQILDVNSMILYEVFLKQTDIEQKVCIVWSEMPRIYVHALK
RGELQIVLTTKRRPEGIIGGPIIKHKMLSREVYNVLLFPSSYQAGYGGVAVVDIHGNGDQ
LAIVGWLNSNVSVERKGMVPNVIFISLEKNDGRHRTSKTIRGKLTHLKNSSFMFEVSIHL
NAVEQRWLSRGHLLMTLAGEQLFPKHFVGLFMPKQSCDVYQAVLSENFNMTTQEPNGTAG
YAIIEILKDSAAKYKVKVADFKEEQLYGFTIERETRQNRKRVIAESSSPKEFLNGLTFGT
LTHFLNVRNLQLLFREKLMFEMADEDGNSLLRGPIRRVLHNDAVTLTNNLPTLLAGNGFK
KRVNTSAAGIAWFATVDVEETCLLYYAVTLSSLPALKSEEITMNLCNRVNEKCLLELKNI
KSFNTDLKEIYLYGHVPLAPLAVLNALADEQLYLNISTLSHPTGEIAGNISIENNCKPRR
LQRDSFVAEDQAVNMLMRTNDCIYHEVTYNDGSSWPALHEECTTCSCQRGNIKCDPILCP
QADCADPVKQPGECCPVCQMSDSNTSVEKGCFWTADNKWHAAGSSWHPYLPPFGYSRCAL
CTCLHSTSEVMCRKTTCPTPACPPNLRYRENALDCCPKCKDVVQRTEITEQVMPVTSSSL
QGDASPGSCFFNNQWHQDKSVFAPKILHLGSLKCITCKCQNGRVFCQRPSCSSLPCNDRS
RINGCCPSTVASADGGSRDR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]