dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0Y9XJ90 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0Y9XJ90|A0A0Y9XJ90_PLABE) Merozoite surface protein 8 {ECO:0000313|EMBL:CXI59287.1} KW=Complete proteome; Reference proteome OX=5821 OS=Plasmodium berghei. GN=PBK173_000267900 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence length 409
Sequence
MKRSSQIIIFLLLSLVCKFSIGICKENGNGNINKSNNNRVIKKERKRKAKSNANKNEPEN
KEHEIINLYDDVQELLGNERMSMLDKYSILGIDDCSNESENNKIIGEYDLKAMKSVLLYK
NRISKVSLENLYDVKTVFKRCFNKDDPELSKSYEHLQDQAAIEGTTIIDYLSNYILNVYV
KMNDEFIKNDGFKLSKYIPELEIINYALYNGPKELENRIKSGLNEINNIIISESLTSIYS
SVVSGLNINCKIKDDLITILNLSDGKYFKVDFSSQATMIVPGQYSHEHGNMKKISEYFIE
KNRICKNEKCPINSNCYVIDNVETCRCIPGFSKNKESESLKCDIDESTSCENNNGGCDVN
ATCLLLEDKIMCECNNKYNGDGIYCSNAIYYGMNVFVFFLISIVCIYIM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]