dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A101QIX0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A101QIX0|A0A101QIX0_STRCK) Uncharacterized protein {ECO:0000313|EMBL:KUN30683.1} KW=Complete proteome OX=1903 OS=Streptomyces corchorusii (Streptomyces chibaensis). GN=AQJ11_10700 OC=Streptomyces.
Sequence length 277
Sequence
MNKPLLAALSSLAIAGLGATPAVAAPHSAKAAAVTVDFAGTVSLSNCSGSVIRFPGSADT
DPALVLTNGHCLETGFPDPGEVITGQSSSRTFGLLNSAGTKVATLRANQVVYSTMTDTDV
TIYRTTTTYAAIKSSYGISPLTVQDTHPVAGTAIKVVSGYWKRIYGCNIDGFVYRLKEGD
WTWKDSVRYTSACDTIGGTSGSPVIDTATGKVVAVNNTGNEDGQQCTVNNPCEVDANGTV
TVRQGINYAEETYNIPACFTTGNKLNLSAAGCTLPKP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]