dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A146GEX5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A146GEX5|A0A146GEX5_SPHZY) C8b1 {ECO:0000313|EMBL:BAU69629.1} OX=195335 OS=Sphyrna zygaena (Smooth hammerhead) (Squalus zygaena). GN= OC=Carcharhinidae; Sphyrna.
Sequence length 582
Sequence
MLQSVNYILLYAALSITQPNGYCIEILAESNDQSNAVNINKVGGHWKRSLRNPSQPIDCV
HSSWSSWSICDPCQNKRYRYARLEVPSQFGGASCESFDREEESCTAGACRTRNLCEGFVC
ADTGRCVGRRLLCNEDDDCGDQSDEKGCRRVSNACSRDTEQYWAVQHIGSGYNILTETLE
GAVLDNRYYGGSCAPYYMNNVRFRKPYNLEFYSPETEGRFELSLTEHESFSNFTHSRFES
KNKNFGFSFGISLPTIFEIGVSYNSNNFKKMMQKLLKNSASKQSLFHAQFSLQVARFKMK
RRDLMLHYDFFQRVKQLPTAYNYGEYREIFKDYGTHYMSEGVLGGTYEYIWEVDSKKMEK
DGYSLNDARDCAKGGFNVGANIRVYVAVDIKVALCDGLLNVNGEGISQSNYTEDFIVFVR
GGASEHVTALAHKQLPTVELMQEWGDAVEYNPEVIKFKPAPLYELVTSNTFQNAVRIKAN
MRQALEEYLIESSSCRCAPCQNNGVVVLKGTKCVCICPAGFRGTACEITTREDIAVDGKW
SCWSSWSGCRNRQRTRTRQCNNPPPEKGGQMCKGDNQHIISC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]