dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A182UJZ1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A182UJZ1|A0A182UJZ1_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AMEC021782-PA} KW=Complete proteome; Reference proteome OX=34690 OS=Anopheles melas. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence length 339
Sequence
MKRQNIRTLSLVVCTFTYLLIGAAVFDALESETEARRWEFLKSVKASFVAKYNITPEDYH
MIEIVITENKPHKAGPQWKFAGAFYFATVVLAMIGYGHSTPVTIGGKAFCMAYAMVGIPL
GLVMFQSIGERLNKFASVVIRRAKKYLRCQQTEATEMNLMLATGLLSSVIITTGAAVFSR
YEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALINKPGYVALSLVFILFGLAVVAASIN
LLVLRFMTMNAEDIRREEAEMQSSVDGLTTYECESTGKLLSCANLNYCSEIEEEDTSVCS
CTCLGGNSFTTHEHEFLLDQGYHPADIITSTISLKRMSI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]